General Information

  • ID:  hor000897
  • Uniprot ID:  Q8SQD7
  • Protein name:  Galanin-like peptide
  • Gene name:  GALP
  • Organism:  Macaca nemestrina (Pig-tailed macaque)
  • Family:  Galanin family
  • Source:  Animal
  • Expression:  Hypothalamus and pituitary gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0032098 regulation of appetite; GO:0042595 behavioral response to starvation; GO:0042742 defense response to bacterium
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  APAHQGRGGWTLNSAGYLLGPVLHLPQMGDQDRKRETALEILDLWKAIDGLPYSHPLQPS
  • Length:  60(24-83)
  • Propeptide:  MAPSVPLVLLLVLLLSLAETPASAPAHQGRGGWTLNSAGYLLGPVLHLPQMGDQDRKRETALEILDLWKAIDGLPYSHPLQPSKRNVMEAFAKPEIGDLDVLSKKIPKEEDVLKS
  • Signal peptide:  MAPSVPLVLLLVLLLSLAETPAS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Involved in a large number of putative physiological functions in CNS homeostatic processes, including the regulation of gonadotropin-releasing hormone secretion
  • Mechanism:  [Isoform 2]: Cleavage of the signal peptide generates a peptide of 25 amino acids, termed alarin because of the N-terminal alanine and the C-terminal serine. Vasoactive peptide.
  • Cross BBB:  NA
  • Target:  GALR3, GALR2
  • Target Unid:  A0A2K6D643, A0A2K6DJN3
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8SQD7-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor000897_AF2.pdbhor000897_ESM.pdb

Physical Information

Mass: 764008 Formula: C296H460N84O85S
Absent amino acids: CF Common amino acids: L
pI: 6.8 Basic residues: 8
Polar residues: 15 Hydrophobic residues: 20
Hydrophobicity: -46.5 Boman Index: -7704
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 91.17
Instability Index: 5543.33 Extinction Coefficient cystines: 13980
Absorbance 280nm: 236.95

Literature

  • PubMed ID:  NA
  • Title:  NA