HORDB

ID: hor000897
Uniprot ID: Q8SQD7(24-83)
Protein name: Galanin-like peptide
Gene name: GALP
Organism: Macaca nemestrina (Pig-tailed macaque)
Family: Galanin family
Source: animal
Expression: Hypothalamus and pituitary gland.
Disease: NA
Comments: NA
Taxonomy: Macaca (genus), Cercopithecinae (subfamily), Cercopithecidae (family), Cercopithecoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0032098 regulation of appetite; GO:0042595 behavioral response to starvation; GO:0042742 defense response to bacterium
GO CC: GO:0005576 extracellular region

Sequence: APAHQGRGGWTLNSAGYLLGPVLHLPQMGDQDRKRETALEILDLWKAIDGLPYSHPLQPS
Length: 60(24-83)
Propeptide: MAPSVPLVLLLVLLLSLAETPASAPAHQGRGGWTLNSAGYLLGPVLHLPQMGDQDRKRETALEILDLWKAIDGLPYSHPLQPSKRNVMEAFAKPEIGDLDVLSKKIPKEEDVLKS
Signal peptide: MAPSVPLVLLLVLLLSLAETPAS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: Involved in a large number of putative physiological functions in CNS homeostatic processes, including the regulation of gonadotropin-releasing hormone secretion
Mechanism: [Isoform 2]: Cleavage of the signal peptide generates a peptide of 25 amino acids, termed alarin because of the N-terminal alanine and the C-terminal serine. Vasoactive peptide.
Cross BBB: NA
Target: GALR3, GALR2
Target Unid: A0A2K6D643, A0A2K6DJN3
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor000897_AF2.pdb

hor000897_ESM.pdb

Mass:	764008	Formula:	C296H460N84O85S
Absent amino acids:	CF	Common amino acids:	L
pI:	6.8	Basic residues:	8
Polar residues:	15	Hydrophobic residues:	20
Hydrophobicity:	-46.5	Boman Index:	-7704
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	91.17
Instability Index:	5543.33	Extinction Coefficient cystines:	13980
Absorbance 280nm:	236.95